PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6AS_5562B97F7.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 404aa    MW: 43687.4 Da    PI: 6.1943
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6AS_5562B97F7.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92e-173077148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT++Ed+llv+ v+++G g+W+++ r+ g+ R++k+c++rw ++l
  Traes_6AS_5562B97F7.1 30 KGPWTPDEDQLLVEHVRRHGEGSWNAVRRETGLLRCGKSCRLRWANHL 77
                           79******************************99**********9986 PP

2Myb_DNA-binding51.52.3e-1683126146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            rg++++eE+ l+++++++ G++ W++I+++++ gRt++++k++w++
  Traes_6AS_5562B97F7.1  83 RGPFSPEEERLILRLHALIGNK-WARISAHLP-GRTDNEIKNYWNT 126
                            89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.9512577IPR017930Myb domain
SuperFamilySSF466899.36E-3127124IPR009057Homeodomain-like
SMARTSM007171.6E-142979IPR001005SANT/Myb domain
PfamPF002494.7E-163077IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-223184IPR009057Homeodomain-like
CDDcd001674.62E-123277No hitNo description
PROSITE patternPS0017504554IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
PROSITE profilePS5129426.72478132IPR017930Myb domain
SMARTSM007176.8E-1782130IPR001005SANT/Myb domain
PfamPF002491.1E-1583126IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.5E-2685131IPR009057Homeodomain-like
CDDcd001672.58E-1285128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008152Biological Processmetabolic process
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MAVEAPQQPE QAAGGSVEQG AAAGGGRLKK GPWTPDEDQL LVEHVRRHGE GSWNAVRRET  60
GLLRCGKSCR LRWANHLRPN LKRGPFSPEE ERLILRLHAL IGNKWARISA HLPGRTDNEI  120
KNYWNTRLKR RKRAGLALYP PDVEREVALV RAGKLRPIVD ADGNASSLQA PLLLDAAADQ  180
FAWPAAPPFH PAFNNVAPPQ PFQFTGNISH NPQALLAAQV PYLHHDEVSA GLGHANKLYA  240
DALGMPPLVP PSAQELPSNQ SPADAGGPLE MLVLEQDQRL PGAALLRVTS MPELVYNEND  300
YSAWPSGLSG GSGSRSEGDV TSHYGGKCDC FFGADGVKPA KGMPASLAVA EEEVSGLFGG  360
EELVAVWPDK PPESITKDDF NLQMMEMQHL MPPVPLPADE HGLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-30281315107B-MYB
1h8a_C7e-302813125127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3731080.0AK373108.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3021G02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966213.11e-103PREDICTED: uncharacterized protein LOC101767992 isoform X1
TrEMBLW5GDH80.0W5GDH8_WHEAT; Uncharacterized protein
STRINGSi006555m1e-102(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123972632
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.17e-52myb domain protein 101
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]